Lineage for d1n2ua_ (1n2u A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535539Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2535540Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2535778Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2535788Protein Isopentenyl diphosphate isomerase [64370] (2 species)
  7. 2535789Species Escherichia coli [TaxId:562] [64371] (18 PDB entries)
    Uniprot Q46822
  8. 2535800Domain d1n2ua_: 1n2u A: [302757]
    Other proteins in same PDB: d1n2ub2
    automated match to d1q54a_
    complexed with bhi, mg, mn

Details for d1n2ua_

PDB Entry: 1n2u (more details), 1.93 Å

PDB Description: Structure and Mechanism of Action of Isopentenylpyrophosphate-Dimethylallylpyrophosphate Isomerase: complex with the bromohydrine of IPP
PDB Compounds: (A:) isopentenyl diphosphate delta-isomerase

SCOPe Domain Sequences for d1n2ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2ua_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]}
ehvillnaqgvptgtlekyaahtadtrlhlafsswlfnakgqllvtrralskkawpgvwt
nsvaghpqlgesnedavirrcryelgveitppesiypdfryratdpsgivenevcpvfaa
rttsalqinddevmdyqwcdladvlhgidatpwafspwmvmqatnrearkrlsaft

SCOPe Domain Coordinates for d1n2ua_:

Click to download the PDB-style file with coordinates for d1n2ua_.
(The format of our PDB-style files is described here.)

Timeline for d1n2ua_: