SCOPe 2.07: Domain d1mwxb5: 1mwx B:139-327

Lineage for d1mwxb5 (1mwx B:139-327)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily)
   unusual fold

4. Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families)
   automatically mapped to Pfam PF03717

5. Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins)
   contains an insert subdomain of ClpS-like fold

6. Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species)
   the insert subdomain (residues 168-239) is fully ordered

7. Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries)
   Uniprot O54286 27-668

8. Domain d1mwxb5: 1mwx B:139-327 [302750]
   Other proteins in same PDB: d1mwxa4, d1mwxa6, d1mwxb4, d1mwxb6
   automated match to d1vqqa2
   complexed with cd, cl

Details for d1mwxb5

PDB Entry: 1mwx, 1.8 Å

PDB Description: Structure of Penicillin binding protein 2a from methicillin resistant Staphylococcus aureus strain 27r at 1.80 A resolution.

PDB Compounds: (B:) penicillin-binding protein mecA, low-affinity

SCOPe Domain Sequences for d1mwxb5:

Sequence, based on SEQRES records:

>d1mwxb5 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk
kdgkdiqlt

Sequence, based on observed residues (ATOM records):

>d1mwxb5 d.175.1.1 (B:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]}
dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik
qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp
inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkk
dgkdiqlt

Timeline for d1mwxb5:

• d1mwxb5 first appeared in SCOPe 2.06
  
• d1mwxb5 appears in the current release, SCOPe 2.08