Lineage for d1bw9b1 (1bw9 B:549-747)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 977855Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 978070Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 978071Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 978077Domain d1bw9b1: 1bw9 B:549-747 [30275]
    Other proteins in same PDB: d1bw9a2, d1bw9b2
    complexed with edo, ipa, k, na, nad, po4, ppy

Details for d1bw9b1

PDB Entry: 1bw9 (more details), 1.5 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and phenylpyruvate
PDB Compounds: (B:) phenylalanine dehydrogenase

SCOPe Domain Sequences for d1bw9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw9b1 c.2.1.7 (B:549-747) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrare

SCOPe Domain Coordinates for d1bw9b1:

Click to download the PDB-style file with coordinates for d1bw9b1.
(The format of our PDB-style files is described here.)

Timeline for d1bw9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bw9b2