![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
![]() | Protein Penicillin binding protein 2a (PBP2A), C-terminal domain [82838] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [82839] (10 PDB entries) Uniprot O54286 27-668 |
![]() | Domain d1mwxa6: 1mwx A:328-668 [302748] Other proteins in same PDB: d1mwxa4, d1mwxa5, d1mwxb4, d1mwxb5 automated match to d1vqqa3 complexed with cd, cl |
PDB Entry: 1mwx (more details), 1.8 Å
SCOPe Domain Sequences for d1mwxa6:
Sequence, based on SEQRES records: (download)
>d1mwxa6 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken inllndgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm mmainvkdvqdkgmasynakisgkvydelyengnkkydide
>d1mwxa6 e.3.1.1 (A:328-668) Penicillin binding protein 2a (PBP2A), C-terminal domain {Staphylococcus aureus [TaxId: 1280]} idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken inllndgmqqvvnkthkediyrsyanligksgtaelkgrqigwfisydkdnpnmmmainv kdvqdkgmasynakisgkvydelyengnkkydide
Timeline for d1mwxa6: