![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.175: Penicillin binding protein dimerisation domain [56518] (1 superfamily) unusual fold |
![]() | Superfamily d.175.1: Penicillin binding protein dimerisation domain [56519] (2 families) ![]() automatically mapped to Pfam PF03717 |
![]() | Family d.175.1.1: Penicillin binding protein dimerisation domain [56520] (2 proteins) contains an insert subdomain of ClpS-like fold |
![]() | Protein Penicillin binding protein 2a (PBP2A), middle domain [82824] (1 species) the insert subdomain (residues 168-239) is fully ordered |
![]() | Species Staphylococcus aureus [TaxId:1280] [82825] (10 PDB entries) Uniprot O54286 27-668 |
![]() | Domain d1mwxa5: 1mwx A:139-327 [302747] Other proteins in same PDB: d1mwxa4, d1mwxa6, d1mwxb4, d1mwxb6 automated match to d1vqqa2 complexed with cd, cl has additional subdomain(s) that are not in the common domain |
PDB Entry: 1mwx (more details), 1.8 Å
SCOPe Domain Sequences for d1mwxa5:
Sequence, based on SEQRES records: (download)
>d1mwxa5 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]} dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddnsntiahtliekkk kdgkdiqlt
>d1mwxa5 d.175.1.1 (A:139-327) Penicillin binding protein 2a (PBP2A), middle domain {Staphylococcus aureus [TaxId: 1280]} dqsihienlksergkildrnnvelantgtayeigivpknvskkdykaiakelsisedyik qqmdqnwvqddtfvplktvkkmdeylsdfakkfhlttnetesrnyplekatshllgyvgp inseelkqkeykgykddavigkkgleklydkklqhedgyrvtivddsntiahtliekkkk dgkdiqlt
Timeline for d1mwxa5: