Lineage for d1mwfd1 (1mwf D:2-99,D:231-494)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437427Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2437428Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein)
  6. 2437429Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species)
  7. 2437454Species Tritrichomonas foetus [TaxId:5724] [51417] (10 PDB entries)
  8. 2437458Domain d1mwfd1: 1mwf D:2-99,D:231-494 [302745]
    automated match to d1lrta1
    complexed with k, mzp, trs

Details for d1mwfd1

PDB Entry: 1mwf (more details), 2 Å

PDB Description: An Immunosuppressive Agent forms A Transition State Analog Complex of IMP Dehydrogenase
PDB Compounds: (D:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d1mwfd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwfd1 c.1.5.1 (D:2-99,D:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]}
akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs
vsgekmaialareggisfifgsqsiesqaamvhavknfXrylvgagintrdfrervpalv
eagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfiki
gigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlal
amgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfee
gvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdv
ivk

SCOPe Domain Coordinates for d1mwfd1:

Click to download the PDB-style file with coordinates for d1mwfd1.
(The format of our PDB-style files is described here.)

Timeline for d1mwfd1: