Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.1: Inosine monophosphate dehydrogenase (IMPDH) [51413] (1 protein) |
Protein Inosine monophosphate dehydrogenase (IMPDH) [51414] (8 species) |
Species Tritrichomonas foetus [TaxId:5724] [51417] (10 PDB entries) |
Domain d1mwfd1: 1mwf D:2-99,D:231-494 [302745] automated match to d1lrta1 complexed with k, mzp, trs |
PDB Entry: 1mwf (more details), 2 Å
SCOPe Domain Sequences for d1mwfd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwfd1 c.1.5.1 (D:2-99,D:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} akyynepchtfneyllipglstvdcipsnvnlstplvkfqkgqqseinlkiplvsaimqs vsgekmaialareggisfifgsqsiesqaamvhavknfXrylvgagintrdfrervpalv eagadvlcidssdgfsewqkitigwirdkygdkvkvgagnivdgegfryladagadfiki gigggsicitreqkgigrgqatavidvvaernkyfeetgiyipvcsdggivydyhmtlal amgadfimlgryfarfeesptrkvtingsvmkeywgegssrarnwqrydlggkqklsfee gvdsyvpyagklkdnveaslnkvkstmcncgaltipqlqskakitlvssvsiveggahdv ivk
Timeline for d1mwfd1: