Lineage for d1bw9a1 (1bw9 A:149-350)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845410Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 2845411Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 2845416Domain d1bw9a1: 1bw9 A:149-350 [30274]
    Other proteins in same PDB: d1bw9a2, d1bw9b2
    complexed with edo, ipa, k, na, nad, po4, ppy
    has additional insertions and/or extensions that are not grouped together

Details for d1bw9a1

PDB Entry: 1bw9 (more details), 1.5 Å

PDB Description: phenylalanine dehydrogenase structure in ternary complex with nad+ and phenylpyruvate
PDB Compounds: (A:) phenylalanine dehydrogenase

SCOPe Domain Sequences for d1bw9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bw9a1 c.2.1.7 (A:149-350) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrareast

SCOPe Domain Coordinates for d1bw9a1:

Click to download the PDB-style file with coordinates for d1bw9a1.
(The format of our PDB-style files is described here.)

Timeline for d1bw9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bw9a2