SCOPe 2.08: Domain d1mcue_: 1mcu E:

Lineage for d1mcue_ (1mcu E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (500 PDB entries)
   Uniprot P00760

8. Domain d1mcue_: 1mcu E: [302731]
   Other proteins in same PDB: d1mcui_
   automated match to d1tgsz_
   complexed with ca

Details for d1mcue_

PDB Entry: 1mcu, 1.8 Å

PDB Description: crystal structure of the complex formed between bovine beta-trypsin and mcti-a, a trypsin inhibitor of squash family at 1.8a resolution

PDB Compounds: (E:) protein (trypsin)

SCOPe Domain Sequences for d1mcue_:

Sequence; same for both SEQRES and ATOM records:

>d1mcue_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdscksaypgqitsnmfcagyleggkdscqgdsggpv
vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1mcue_:

• d1mcue_ first appeared in SCOPe 2.06
  
• d1mcue_ appears in SCOPe 2.07