Lineage for d1m80b4 (1m80 B:96-357)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538454Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 protein domains)
    automatically mapped to Pfam PF00217
  6. 2538455Protein Arginine kinase, C-terminal domain [55942] (2 species)
  7. 2538465Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (14 PDB entries)
    Uniprot P51541
  8. 2538478Domain d1m80b4: 1m80 B:96-357 [302730]
    Other proteins in same PDB: d1m80a3, d1m80b3
    automated match to d1m15a2

Details for d1m80b4

PDB Entry: 1m80 (more details), 2.35 Å

PDB Description: substrate free form of arginine kinase
PDB Compounds: (B:) arginine kinase

SCOPe Domain Sequences for d1m80b4:

Sequence, based on SEQRES records: (download)

>d1m80b4 d.128.1.2 (B:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

Sequence, based on observed residues (ATOM records): (download)

>d1m80b4 d.128.1.2 (B:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvgvydisnkrrlglteyqavremqdgil
emikmekaaa

SCOPe Domain Coordinates for d1m80b4:

Click to download the PDB-style file with coordinates for d1m80b4.
(The format of our PDB-style files is described here.)

Timeline for d1m80b4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m80b3