SCOP 1.69: Domain d1c1xb1: 1c1x B:149-347

Lineage for d1c1xb1 (1c1x B:149-347)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Phenylalanine dehydrogenase [51892] (1 species)

7. Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)

8. Domain d1c1xb1: 1c1x B:149-347 [30273]
   Other proteins in same PDB: d1c1xa2, d1c1xb2

Details for d1c1xb1

PDB Entry: 1c1x, 1.4 Å

PDB Description: l-phenylalanine dehydrogenase structure in ternary complex with nad+ and l-3-phenyllactate

SCOP Domain Sequences for d1c1xb1:

Sequence; same for both SEQRES and ATOM records:

>d1c1xb1 c.2.1.7 (B:149-347) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrare

Timeline for d1c1xb1:

• d1c1xb1 first appeared (with stable ids) in SCOP 1.55
  
• d1c1xb1 appears in SCOP 1.67
  
• d1c1xb1 appears in SCOP 1.71
  
• d1c1xb1 appears in the current release, SCOPe 2.08