Lineage for d1c1xb1 (1c1x B:149-347)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20664Family c.2.1.7: Amino-acid dehydrogenase-like, C-terminal domain [51883] (5 proteins)
  6. 20757Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 20758Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 20762Domain d1c1xb1: 1c1x B:149-347 [30273]
    Other proteins in same PDB: d1c1xa2, d1c1xb2

Details for d1c1xb1

PDB Entry: 1c1x (more details), 1.4 Å

PDB Description: l-phenylalanine dehydrogenase structure in ternary complex with nad+ and l-3-phenyllactate

SCOP Domain Sequences for d1c1xb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1xb1 c.2.1.7 (B:149-347) Phenylalanine dehydrogenase {Rhodococcus sp., M4}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrare

SCOP Domain Coordinates for d1c1xb1:

Click to download the PDB-style file with coordinates for d1c1xb1.
(The format of our PDB-style files is described here.)

Timeline for d1c1xb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1xb2