![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Phenylalanine dehydrogenase [51892] (1 species) |
![]() | Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries) |
![]() | Domain d1c1xb1: 1c1x B:149-347 [30273] Other proteins in same PDB: d1c1xa2, d1c1xb2 complexed with hfa, ipa, k, na, nad, po4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1c1x (more details), 1.4 Å
SCOPe Domain Sequences for d1c1xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1xb1 c.2.1.7 (B:149-347) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn dgvtpdeaartlagrrare
Timeline for d1c1xb1: