![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
![]() | Protein Arginine kinase, N-domain [48042] (2 species) |
![]() | Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (14 PDB entries) Uniprot P51541 |
![]() | Domain d1m80b3: 1m80 B:2-95 [302729] Other proteins in same PDB: d1m80a4, d1m80b4 automated match to d1m15a1 |
PDB Entry: 1m80 (more details), 2.35 Å
SCOPe Domain Sequences for d1m80b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m80b3 a.83.1.1 (B:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]} vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl dsgvgiyapdaesyrtfgplfdpiiddyhggfkl
Timeline for d1m80b3: