Lineage for d1m80b3 (1m80 B:2-95)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719236Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 2719237Protein Arginine kinase, N-domain [48042] (2 species)
  7. 2719247Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (14 PDB entries)
    Uniprot P51541
  8. 2719259Domain d1m80b3: 1m80 B:2-95 [302729]
    Other proteins in same PDB: d1m80a4, d1m80b4
    automated match to d1m15a1

Details for d1m80b3

PDB Entry: 1m80 (more details), 2.35 Å

PDB Description: substrate free form of arginine kinase
PDB Compounds: (B:) arginine kinase

SCOPe Domain Sequences for d1m80b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m80b3 a.83.1.1 (B:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOPe Domain Coordinates for d1m80b3:

Click to download the PDB-style file with coordinates for d1m80b3.
(The format of our PDB-style files is described here.)

Timeline for d1m80b3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m80b4