Lineage for d1m5mb_ (1m5m B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407676Fold b.89: Cyanovirin-N [51321] (1 superfamily)
    complex fold
  4. 2407677Superfamily b.89.1: Cyanovirin-N [51322] (2 families) (S)
    duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
    automatically mapped to Pfam PF08881
  5. 2407678Family b.89.1.1: Cyanovirin-N [51323] (2 protein domains)
  6. 2407679Protein Cyanovirin-N [51324] (1 species)
  7. 2407680Species Nostoc ellipsosporum [TaxId:45916] [51325] (18 PDB entries)
  8. 2407709Domain d1m5mb_: 1m5m B: [302726]
    automated match to d3ezma_
    complexed with nhe

Details for d1m5mb_

PDB Entry: 1m5m (more details), 2.5 Å

PDB Description: crystal structure of cyanovirin-n complexed to oligomannose-9 (man-9)
PDB Compounds: (B:) Cyanovirin-N

SCOPe Domain Sequences for d1m5mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5mb_ b.89.1.1 (B:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

SCOPe Domain Coordinates for d1m5mb_:

Click to download the PDB-style file with coordinates for d1m5mb_.
(The format of our PDB-style files is described here.)

Timeline for d1m5mb_: