SCOPe 2.08: Domain d1m5ja_: 1m5j A:

Lineage for d1m5ja_ (1m5j A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.89: Cyanovirin-N [51321] (1 superfamily)
   complex fold

4. Superfamily b.89.1: Cyanovirin-N [51322] (2 families)
   duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
   automatically mapped to Pfam PF08881

5. Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)

6. Protein Cyanovirin-N [51324] (1 species)

7. Species Nostoc ellipsosporum [TaxId:45916] [51325] (18 PDB entries)

8. Domain d1m5ja_: 1m5j A: [302723]
   automated match to d3ezma_
   complexed with nhe

Details for d1m5ja_

PDB Entry: 1m5j, 2.4 Å

PDB Description: crystal structure of cyanovirin-n complexed to a synthetic hexamannoside

PDB Compounds: (A:) Cyanovirin-N

SCOPe Domain Sequences for d1m5ja_:

Sequence; same for both SEQRES and ATOM records:

>d1m5ja_ b.89.1.1 (A:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqpsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

Timeline for d1m5ja_:

• d1m5ja_ first appeared in SCOPe 2.06
  
• d1m5ja_ appears in SCOPe 2.07