| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
| Protein automated matches [190785] (5 species) not a true protein |
| Species Pyrococcus furiosus [311162] (1 PDB entry) |
| Domain d1m2ya_: 1m2y A: [302720] automated match to d4ar6a_ mutant |
PDB Entry: 1m2y (more details)
SCOPe Domain Sequences for d1m2ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2ya_ g.41.5.1 (A:) automated matches {Pyrococcus furiosus}
akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefek
Timeline for d1m2ya_: