![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
![]() | Protein Phenylalanine dehydrogenase [51892] (1 species) |
![]() | Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries) |
![]() | Domain d1c1xa1: 1c1x A:149-348 [30272] Other proteins in same PDB: d1c1xa2, d1c1xb2 |
PDB Entry: 1c1x (more details), 1.4 Å
SCOP Domain Sequences for d1c1xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1xa1 c.2.1.7 (A:149-348) Phenylalanine dehydrogenase {Rhodococcus sp., M4} safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn dgvtpdeaartlagrrarea
Timeline for d1c1xa1: