Lineage for d1lusb4 (1lus B:84-198)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946003Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. 2946275Protein automated matches [226880] (5 species)
    not a true protein
  7. 2946291Species Human (Homo sapiens) [TaxId:9606] [255569] (2 PDB entries)
  8. 2946293Domain d1lusb4: 1lus B:84-198 [302719]
    Other proteins in same PDB: d1lusa3, d1lusb3
    automated match to d2p4ka2
    complexed with mn

Details for d1lusb4

PDB Entry: 1lus (more details), 2.11 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human mnsod: insertion of val cgamma into the substrate access channel
PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1lusb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lusb4 d.44.1.1 (B:84-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

SCOPe Domain Coordinates for d1lusb4:

Click to download the PDB-style file with coordinates for d1lusb4.
(The format of our PDB-style files is described here.)

Timeline for d1lusb4:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lusb3