SCOPe 2.06: Domain d1lusb3: 1lus B:1-83

Lineage for d1lusb3 (1lus B:1-83)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein automated matches [227044] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255568] (2 PDB entries)

8. Domain d1lusb3: 1lus B:1-83 [302718]
   Other proteins in same PDB: d1lusa4, d1lusb4
   automated match to d1pl4a1
   complexed with mn

Details for d1lusb3

PDB Entry: 1lus, 2.11 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human mnsod: insertion of val cgamma into the substrate access channel

PDB Compounds: (B:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1lusb3:

Sequence; same for both SEQRES and ATOM records:

>d1lusb3 a.2.11.1 (B:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskvhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1lusb3:

• d1lusb3 is new in SCOPe 2.06-stable
  
• d1lusb3 appears in SCOPe 2.07
  
• d1lusb3 appears in the current release, SCOPe 2.08