SCOPe 2.08: Domain d1lusa4: 1lus A:84-198

Lineage for d1lusa4 (1lus A:84-198)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein automated matches [226880] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255569] (2 PDB entries)

8. Domain d1lusa4: 1lus A:84-198 [302717]
   Other proteins in same PDB: d1lusa3, d1lusb3
   automated match to d2p4ka2
   complexed with mn

Details for d1lusa4

PDB Entry: 1lus, 2.11 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human mnsod: insertion of val cgamma into the substrate access channel

PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1lusa4:

Sequence; same for both SEQRES and ATOM records:

>d1lusa4 d.44.1.1 (A:84-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayylqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1lusa4:

• d1lusa4 first appeared in SCOPe 2.06
  
• d1lusa4 appears in SCOPe 2.07