Lineage for d1lusa3 (1lus A:1-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690050Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. 2690322Protein automated matches [227044] (4 species)
    not a true protein
  7. 2690331Species Human (Homo sapiens) [TaxId:9606] [255568] (2 PDB entries)
  8. 2690332Domain d1lusa3: 1lus A:1-83 [302716]
    Other proteins in same PDB: d1lusa4, d1lusb4
    automated match to d1pl4a1
    complexed with mn

Details for d1lusa3

PDB Entry: 1lus (more details), 2.11 Å

PDB Description: catalytic and structural effects of amino-acid substitution at his 30 in human mnsod: insertion of val cgamma into the substrate access channel
PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d1lusa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lusa3 a.2.11.1 (A:1-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskvhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d1lusa3:

Click to download the PDB-style file with coordinates for d1lusa3.
(The format of our PDB-style files is described here.)

Timeline for d1lusa3:

View in 3D
Domains from same chain:
(mouse over for more information)
d1lusa4