| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon [88596] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88597] (4 PDB entries) |
| Domain d1ls0b5: 1ls0 B:331-438 [302714] Other proteins in same PDB: d1ls0a4, d1ls0a6, d1ls0b4, d1ls0b6 automated match to d1o0vb2 complexed with gol, so4 |
PDB Entry: 1ls0 (more details), 2.6 Å
SCOPe Domain Sequences for d1ls0b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ls0b5 b.1.1.2 (B:331-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]}
snprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkee
kqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg
Timeline for d1ls0b5: