Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon [88594] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [88595] (3 PDB entries) |
Domain d1ls0b4: 1ls0 B:228-330 [302713] Other proteins in same PDB: d1ls0a5, d1ls0a6, d1ls0b5, d1ls0b6 automated match to d1o0vb1 complexed with gol, so4 |
PDB Entry: 1ls0 (more details), 2.6 Å
SCOPe Domain Sequences for d1ls0b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ls0b4 b.1.1.2 (B:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} dftpptvkilqsscdggghfpptiqllclvsgytpgtiqitwledgqvmdvdlstasttq egelastqseltlsqkhwlsdrtytcqvtyqghtfedstkkcad
Timeline for d1ls0b4: