SCOPe 2.08: Domain d1ls0a6: 1ls0 A:439-545

Lineage for d1ls0a6 (1ls0 A:439-545)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon [88598] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88599] (4 PDB entries)

8. Domain d1ls0a6: 1ls0 A:439-545 [302712]
   Other proteins in same PDB: d1ls0a4, d1ls0a5, d1ls0b4, d1ls0b5
   automated match to d1o0va3
   complexed with gol, so4

Details for d1ls0a6

PDB Entry: 1ls0, 2.6 Å

PDB Description: The crystal structure of IgE Fc reveals an asymmetrically bent conformation

PDB Compounds: (A:) Immunoglobulin heavy chain epsilon-1

SCOPe Domain Sequences for d1ls0a6:

Sequence; same for both SEQRES and ATOM records:

>d1ls0a6 b.1.1.2 (A:439-545) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]}
praapevyafatpewpgsrdkrtlacliqnfmpedisvqwlhnevqlpdarhsttqprkt
kgsgffvfsrlevtraeweqkdeficravheaaspsqtvqravsvnp

Timeline for d1ls0a6:

• d1ls0a6 first appeared in SCOPe 2.06
  
• d1ls0a6 appears in SCOPe 2.07