Lineage for d1ls0a5 (1ls0 A:331-438)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358946Protein Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon [88596] (1 species)
  7. 2358947Species Human (Homo sapiens) [TaxId:9606] [88597] (4 PDB entries)
  8. 2358949Domain d1ls0a5: 1ls0 A:331-438 [302711]
    Other proteins in same PDB: d1ls0a4, d1ls0a6, d1ls0b4, d1ls0b6
    automated match to d1o0va2
    complexed with gol, so4

Details for d1ls0a5

PDB Entry: 1ls0 (more details), 2.6 Å

PDB Description: The crystal structure of IgE Fc reveals an asymmetrically bent conformation
PDB Compounds: (A:) Immunoglobulin heavy chain epsilon-1

SCOPe Domain Sequences for d1ls0a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ls0a5 b.1.1.2 (A:331-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]}
snprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkee
kqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

SCOPe Domain Coordinates for d1ls0a5:

Click to download the PDB-style file with coordinates for d1ls0a5.
(The format of our PDB-style files is described here.)

Timeline for d1ls0a5: