SCOPe 2.08: Domain d1ls0a5: 1ls0 A:331-438

Lineage for d1ls0a5 (1ls0 A:331-438)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon [88596] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88597] (4 PDB entries)

8. Domain d1ls0a5: 1ls0 A:331-438 [302711]
   Other proteins in same PDB: d1ls0a4, d1ls0a6, d1ls0b4, d1ls0b6
   automated match to d1o0va2
   complexed with gol, so4

Details for d1ls0a5

PDB Entry: 1ls0, 2.6 Å

PDB Description: The crystal structure of IgE Fc reveals an asymmetrically bent conformation

PDB Compounds: (A:) Immunoglobulin heavy chain epsilon-1

SCOPe Domain Sequences for d1ls0a5:

Sequence; same for both SEQRES and ATOM records:

>d1ls0a5 b.1.1.2 (A:331-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]}
snprgvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvnhstrkee
kqrngtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Timeline for d1ls0a5:

• d1ls0a5 first appeared in SCOPe 2.06
  
• d1ls0a5 appears in SCOPe 2.07