Lineage for d1c1db1 (1c1d B:149-348)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845410Protein Phenylalanine dehydrogenase [51892] (1 species)
  7. 2845411Species Rhodococcus sp., M4 [TaxId:1831] [51893] (4 PDB entries)
  8. 2845413Domain d1c1db1: 1c1d B:149-348 [30271]
    Other proteins in same PDB: d1c1da2, d1c1db2
    complexed with ipa, k, na, nai, phe, po4
    has additional insertions and/or extensions that are not grouped together

Details for d1c1db1

PDB Entry: 1c1d (more details), 1.25 Å

PDB Description: l-phenylalanine dehydrogenase structure in ternary complex with nadh and l-phenylalanine
PDB Compounds: (B:) l-phenylalanine dehydrogenase

SCOPe Domain Sequences for d1c1db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1db1 c.2.1.7 (B:149-348) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]}
safttavgvfeamkatvahrglgsldgltvlvqglgavggslaslaaeagaqllvadtdt
ervahavalghtavaledvlstpcdvfapcamggvittevartldcsvvagaannviade
aasdilhargilyapdfvanaggaihlvgrevlgwsesvvheravaigdtlnqvfeisdn
dgvtpdeaartlagrrarea

SCOPe Domain Coordinates for d1c1db1:

Click to download the PDB-style file with coordinates for d1c1db1.
(The format of our PDB-style files is described here.)

Timeline for d1c1db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c1db2