Lineage for d1liyd4 (1liy D:62-159,D:262-439)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088021Family c.1.12.1: Pyruvate kinase [51622] (1 protein)
  6. 2088022Protein Pyruvate kinase, N-terminal domain [51623] (6 species)
    this domain is interrupted by an all-beta domain
    C-terminal domain is alpha/beta
  7. 2088043Species Human (Homo sapiens) [TaxId:9606] [82273] (8 PDB entries)
  8. 2088057Domain d1liyd4: 1liy D:62-159,D:262-439 [302703]
    Other proteins in same PDB: d1liyb5, d1liyd5, d1liyd6
    automated match to d2vggb2
    complexed with fbp, k, mn, pga; mutant

Details for d1liyd4

PDB Entry: 1liy (more details), 2.74 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg479His mutant
PDB Compounds: (D:) Pyruvate kinase, isozymes R/L

SCOPe Domain Sequences for d1liyd4:

Sequence, based on SEQRES records: (download)

>d1liyd4 c.1.12.1 (D:62-159,D:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
paamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniarlnfsh
gsheyhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgvehgvdi
vfasfvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgi
eipaekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadci
mlsgetakgnfpveavkmqhaiareaeaavyhrqlfe

Sequence, based on observed residues (ATOM records): (download)

>d1liyd4 c.1.12.1 (D:62-159,D:262-439) Pyruvate kinase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
paatflehlcllidsepvaarstsiiatigpasrsverlkemikagmniarlnfshgshe
yhaesianvreavesfagsplsyrpvaialdtkgXpglseqdvrdlrfgvehgvdivfas
fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
etakgnfpveavkmqhaiareaeaavyhrqlfe

SCOPe Domain Coordinates for d1liyd4:

Click to download the PDB-style file with coordinates for d1liyd4.
(The format of our PDB-style files is described here.)

Timeline for d1liyd4:

  • d1liyd4 is new in SCOPe 2.06-stable