Class b: All beta proteins [48724] (180 folds) |
Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily) barrel, closed; n=7, S=10; complex topology |
Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) |
Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein) this domain interrupts beta/alpha-barrel domain C-terminal domain is alpha/beta |
Protein Pyruvate kinase (PK) [50802] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [82151] (8 PDB entries) |
Domain d1liuc5: 1liu C:160-261 [302680] Other proteins in same PDB: d1liua4, d1liua6, d1liub4, d1liub5, d1liuc4, d1liuc6, d1liud4, d1liud6 automated match to d2vgba1 complexed with fbp, k, mn, pga |
PDB Entry: 1liu (more details), 2.72 Å
SCOPe Domain Sequences for d1liuc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1liuc5 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]} peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl
Timeline for d1liuc5: