Lineage for d1leha1 (1leh A:135-364)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388514Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 388619Protein Leucine dehydrogenase [51890] (1 species)
  7. 388620Species Bacillus sphaericus [TaxId:1421] [51891] (1 PDB entry)
  8. 388621Domain d1leha1: 1leh A:135-364 [30268]
    Other proteins in same PDB: d1leha2, d1lehb2

Details for d1leha1

PDB Entry: 1leh (more details), 2.2 Å

PDB Description: leucine dehydrogenase from bacillus sphaericus

SCOP Domain Sequences for d1leha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus}
gispafgssgnpspvtaygvyrgmkaaakeafgsdsleglavsvqglgnvakalckklnt
egaklvvtdvnkaavsaavaeegadavapnaiygvtcdifapcalgavlndftipqlkak
viagsadnqlkdprhgkylhelgivyapdyvinaggvinvadelygynrtramkrvdgiy
dsiekifaiskrdgvpsyvaadrmaeeriakvakarsqflqdqrnilngr

SCOP Domain Coordinates for d1leha1:

Click to download the PDB-style file with coordinates for d1leha1.
(The format of our PDB-style files is described here.)

Timeline for d1leha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1leha2