Lineage for d1lgga_ (1lgg A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888269Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)
  8. 2888278Domain d1lgga_: 1lgg A: [302672]
    automated match to d1lx7b_

Details for d1lgga_

PDB Entry: 1lgg (more details), 2.2 Å

PDB Description: Crystal Structure of E.coli Uridine Phosphorylase at 2.2 A Resolution
PDB Compounds: (A:) Uridine phosphorylase

SCOPe Domain Sequences for d1lgga_:

Sequence, based on SEQRES records: (download)

>d1lgga_ c.56.2.1 (A:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d1lgga_ c.56.2.1 (A:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
ksdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpv
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
faplefpavadfecttalveaaksigatthvgvtassdtfsmeewqamgvmnyemesatl
ltmcasqglragmvagvivnrttmkqteshavkivveaarrll

SCOPe Domain Coordinates for d1lgga_:

Click to download the PDB-style file with coordinates for d1lgga_.
(The format of our PDB-style files is described here.)

Timeline for d1lgga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1lggb_