SCOP 1.65: Domain d1hwyf1: 1hwy F:209-501

Lineage for d1hwyf1 (1hwy F:209-501)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (10 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Glutamate dehydrogenase [51884] (7 species)

7. Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries)

8. Domain d1hwyf1: 1hwy F:209-501 [30267]
   Other proteins in same PDB: d1hwya2, d1hwyb2, d1hwyc2, d1hwyd2, d1hwye2, d1hwyf2
   complexed with akg, nad, po4

Details for d1hwyf1

PDB Entry: 1hwy, 3.2 Å

PDB Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate

SCOP Domain Sequences for d1hwyf1:

Sequence; same for both SEQRES and ATOM records:

>d1hwyf1 c.2.1.7 (F:209-501) Glutamate dehydrogenase {Cow (Bos taurus)}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

Timeline for d1hwyf1:

• d1hwyf1 first appeared (with stable ids) in SCOP 1.55
  
• d1hwyf1 appears in SCOP 1.63
  
• d1hwyf1 appears in SCOP 1.67
  
• d1hwyf1 appears in the current release, SCOPe 2.08