SCOPe 2.08: Domain d1l9fb4: 1l9f B:218-321

Lineage for d1l9fb4 (1l9f B:218-321)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.3: D-aminoacid oxidase-like [54384] (3 proteins)

6. Protein Sarcosine oxidase [54388] (1 species)

7. Species Bacillus sp., strain b0618 [TaxId:1409] [54389] (17 PDB entries)

8. Domain d1l9fb4: 1l9f B:218-321 [302667]
   Other proteins in same PDB: d1l9fa3, d1l9fb3
   automated match to d1l9ea2
   complexed with cl, fad, po4

Details for d1l9fb4

PDB Entry: 1l9f, 1.85 Å

PDB Description: Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme

PDB Compounds: (B:) Monomeric sarcosine oxidase

SCOPe Domain Sequences for d1l9fb4:

Sequence; same for both SEQRES and ATOM records:

>d1l9fb4 d.16.1.3 (B:218-321) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]}
lqpyrqvvgffesdeskysndidfpgfmvevpngiyygfpsfggcglklgyhtfgqkidp
dtinrefgvypedesnlrafleeympgangelkrgavcmytktl

Timeline for d1l9fb4:

• d1l9fb4 first appeared in SCOPe 2.06
  
• d1l9fb4 appears in SCOPe 2.07