| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins) extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site |
| Protein Glutamate dehydrogenase [51884] (8 species) |
| Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries) |
| Domain d1hwye1: 1hwy E:209-501 [30266] Other proteins in same PDB: d1hwya2, d1hwyb2, d1hwyc2, d1hwyd2, d1hwye2, d1hwyf2 complexed with akg, nad, po4 |
PDB Entry: 1hwy (more details), 3.2 Å
SCOPe Domain Sequences for d1hwye1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hwye1 c.2.1.7 (E:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft
Timeline for d1hwye1: