SCOPe 2.08: Domain d1l7sh3: 1l7s H:1-118

Lineage for d1l7sh3 (1l7s H:1-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.1 [TaxId:10090] [88549] (15 PDB entries)
   Uniprot P18527 # HV56_MOUSE Ig heavy chain V region 914; 90% sequence identity

8. Domain d1l7sh3: 1l7s H:1-118 [302656]
   Other proteins in same PDB: d1l7sh4, d1l7sl3, d1l7sl4
   automated match to d1vpoh1
   complexed with tes

Details for d1l7sh3

PDB Entry: 1l7s, 2.15 Å

PDB Description: Crystal Structure Analysis of the Anti-testosterone Fab in Complex with Testosterone

PDB Compounds: (H:) anti-testosterone (heavy chain)

SCOPe Domain Sequences for d1l7sh3:

Sequence; same for both SEQRES and ATOM records:

>d1l7sh3 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]}
evklvesggglvkpggslklscaasgftfsryalswvrqtadkrlewvasivsggntyys
gsvkgrftisrdiarnilylqmsslrsedtamyycarayygyvglvhwgqgtlvtvss

Timeline for d1l7sh3:

• d1l7sh3 first appeared in SCOPe 2.06
  
• d1l7sh3 appears in SCOPe 2.07