Lineage for d1l6kh_ (1l6k H:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2647063Fold h.6: Apolipoprotein A-II [82935] (1 superfamily)
    segmented tetrameric parallel coiled coil
  4. 2647064Superfamily h.6.1: Apolipoprotein A-II [82936] (1 family) (S)
  5. 2647065Family h.6.1.1: Apolipoprotein A-II [82937] (1 protein)
  6. 2647066Protein Apolipoprotein A-II [82938] (1 species)
  7. 2647067Species Human (Homo sapiens) [TaxId:9606] [82939] (3 PDB entries)
  8. 2647086Domain d1l6kh_: 1l6k H: [302651]
    automated match to d2ou1a_

Details for d1l6kh_

PDB Entry: 1l6k (more details), 2 Å

PDB Description: Structures of Apolipoprotein A-II and a Lipid Surrogate Complex Provide Insights into Apolipoprotein-Lipid Interactions
PDB Compounds: (H:) Apolipoprotein A-II

SCOPe Domain Sequences for d1l6kh_:

Sequence, based on SEQRES records: (download)

>d1l6kh_ h.6.1.1 (H:) Apolipoprotein A-II {Human (Homo sapiens) [TaxId: 9606]}
epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnf
lsyfvelgtqpat

Sequence, based on observed residues (ATOM records): (download)

>d1l6kh_ h.6.1.1 (H:) Apolipoprotein A-II {Human (Homo sapiens) [TaxId: 9606]}
epceslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnfl
syfvelgtqpat

SCOPe Domain Coordinates for d1l6kh_:

Click to download the PDB-style file with coordinates for d1l6kh_.
(The format of our PDB-style files is described here.)

Timeline for d1l6kh_: