Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.6: Apolipoprotein A-II [82935] (1 superfamily) segmented tetrameric parallel coiled coil |
Superfamily h.6.1: Apolipoprotein A-II [82936] (1 family) |
Family h.6.1.1: Apolipoprotein A-II [82937] (1 protein) |
Protein Apolipoprotein A-II [82938] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82939] (3 PDB entries) |
Domain d1l6kg_: 1l6k G: [302650] automated match to d2ou1a_ |
PDB Entry: 1l6k (more details), 2 Å
SCOPe Domain Sequences for d1l6kg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l6kg_ h.6.1.1 (G:) Apolipoprotein A-II {Human (Homo sapiens) [TaxId: 9606]} epcveslvsqyfqtvtdygkdlmekvkspelqaeaksyfekskeqltplikkagtelvnf lsyfvelgtqpat
Timeline for d1l6kg_: