SCOPe 2.01: Domain d1hwyd1: 1hwy D:209-501

Lineage for d1hwyd1 (1hwy D:209-501)

Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

Protein Glutamate dehydrogenase [51884] (8 species)
Species Cow (Bos taurus) [TaxId:9913] [51889] (5 PDB entries)
Domain d1hwyd1: 1hwy D:209-501 [30265]
Other proteins in same PDB: d1hwya2, d1hwyb2, d1hwyc2, d1hwyd2, d1hwye2, d1hwyf2
complexed with akg, nad, po4

Details for d1hwyd1

PDB Entry: 1hwy (more details), 3.2 Å

PDB Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate

PDB Compounds: (D:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hwyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwyd1 c.2.1.7 (D:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOPe Domain Coordinates for d1hwyd1:

Click to download the PDB-style file with coordinates for d1hwyd1.
(The format of our PDB-style files is described here.)

Timeline for d1hwyd1: