Lineage for d1l2ra_ (1l2r A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090064Superfamily c.1.25: Monomethylamine methyltransferase MtmB [75098] (1 family) (S)
    automatically mapped to Pfam PF05369
  5. 2090065Family c.1.25.1: Monomethylamine methyltransferase MtmB [75099] (1 protein)
  6. 2090066Protein Monomethylamine methyltransferase MtmB [75100] (1 species)
    contains a UAG-encoded L-pyrrolysine residue
  7. 2090067Species Methanosarcina barkeri [TaxId:2208] [75101] (6 PDB entries)
    Uniprot O30642
  8. 2090068Domain d1l2ra_: 1l2r A: [302644]
    automated match to d1tv4a_
    complexed with bgx

Details for d1l2ra_

PDB Entry: 1l2r (more details), 1.55 Å

PDB Description: Crystal Structure of the Methanosarcina barkeri Monomethylamine Methyltransferase (MtmB)
PDB Compounds: (A:) monomethylamine methyltransferase

SCOPe Domain Sequences for d1l2ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l2ra_ c.1.25.1 (A:) Monomethylamine methyltransferase MtmB {Methanosarcina barkeri [TaxId: 2208]}
tfrksfdcydfydrakvgekctqddwdlmkipmkamelkqkygldfkgefiptdkdmmek
lfkagfemllecgiyctdthrivkytedeiwdainnvqkefvlgtgrdavnvrkrsvgdk
akpivqggptgspisedvfmpvhmsyalekevdtivngvmtsvrgkspipkspyevlaak
tetrliknacamagrpgmgvkgpetslsaqgnisadctggmtctdshevsqlnelkidld
aisviahykgnsdiimdeqmpifggyaggieettivdvathinavlmssaswhldgpvhi
rwgstntretlmiagwacatiseftdilsgnqyypcagpctemclleasaqsitdtasgr
eilsgvasakgvvtdkttgmearmmgevaratagveisevnvildklvslyeknyasapa
gktfqecydvktvtpteeymqvydgarkkledlglvf

SCOPe Domain Coordinates for d1l2ra_:

Click to download the PDB-style file with coordinates for d1l2ra_.
(The format of our PDB-style files is described here.)

Timeline for d1l2ra_:

  • d1l2ra_ is new in SCOPe 2.06-stable