Lineage for d1kygc_ (1kyg C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2456544Family c.47.1.10: Glutathione peroxidase-like [52901] (29 protein domains)
  6. 2456575Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)
  7. 2456638Species Salmonella typhimurium [TaxId:90371] [69517] (6 PDB entries)
  8. 2456676Domain d1kygc_: 1kyg C: [302643]
    automated match to d4ma9b_
    complexed with so4

Details for d1kygc_

PDB Entry: 1kyg (more details), 2.5 Å

PDB Description: X-ray Crystal Structure of AhpC
PDB Compounds: (C:) Alkyl hydroperoxide reductase C22 protein

SCOPe Domain Sequences for d1kygc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kygc_ c.47.1.10 (C:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpge

SCOPe Domain Coordinates for d1kygc_:

Click to download the PDB-style file with coordinates for d1kygc_.
(The format of our PDB-style files is described here.)

Timeline for d1kygc_: