Lineage for d1ksab_ (1ksa B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2402431Fold b.75: Bacteriochlorophyll A protein [51080] (1 superfamily)
    single sheet; 16 strands; meander
  4. 2402432Superfamily b.75.1: Bacteriochlorophyll A protein [51081] (1 family) (S)
    automatically mapped to Pfam PF02327
  5. 2402433Family b.75.1.1: Bacteriochlorophyll A protein [51082] (2 proteins)
  6. 2402443Protein automated matches [190386] (3 species)
    not a true protein
  7. 2402444Species Chlorobaculum tepidum [TaxId:1097] [187240] (2 PDB entries)
  8. 2402446Domain d1ksab_: 1ksa B: [302637]
    automated match to d3bsda_
    complexed with bcl

Details for d1ksab_

PDB Entry: 1ksa (more details), 2.2 Å

PDB Description: crystal structure of the bacteriochlorophyll a protein from chlorobium tepidum
PDB Compounds: (B:) Bacteriochlorophyll a protein

SCOPe Domain Sequences for d1ksab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ksab_ b.75.1.1 (B:) automated matches {Chlorobaculum tepidum [TaxId: 1097]}
ttahsdyeivleggssswgkvkarakvnappaspllpadcdvklnvkpldpakgfvrisa
vfesivdstknkltieadianetkerrisvgegmvsvgdfshtfsfegsvvnlfyyrsda
vrrnvpnpiymqgrqfhdilmkvpldnndlidtwegtvkaigstgafndwirdfwfigpa
ftalneggqrisrievnglntesgpkgpvgvsrwrfshggsgmvdsisrwaelfpsdkln
rpaqveagfrsdsqgievkvdgefpgvsvdaggglrrilnhpliplvhhgmvgkfnnfnv
daqlkvvlpkgykiryaapqyrsqnleeyrwsggayarwvehvckggvgqfeilyaq

SCOPe Domain Coordinates for d1ksab_:

Click to download the PDB-style file with coordinates for d1ksab_.
(The format of our PDB-style files is described here.)

Timeline for d1ksab_: