Lineage for d1kinb_ (1kin B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109738Protein automated matches [190087] (10 species)
    not a true protein
  7. 2109772Species Herpes simplex virus type i [311158] (1 PDB entry)
  8. 2109774Domain d1kinb_: 1kin B: [302635]
    automated match to d1p7cb_
    protein/DNA complex; complexed with so4, thm

Details for d1kinb_

PDB Entry: 1kin (more details), 2 Å

PDB Description: crystal structure of thymidine kinase from herpes simplex virus type i complexed with deoxythymidine
PDB Compounds: (B:) Thymidine kinase

SCOPe Domain Sequences for d1kinb_:

Sequence, based on SEQRES records: (download)

>d1kinb_ c.37.1.1 (B:) automated matches {Herpes simplex virus type i}
mptllrvyidgphgmgkttttqllvalgsrddivyvpepmtywrvlgasetianiyttqh
rldqgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagsshapppaltlifdrhp
iaallcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpge
rldlamlaairrvygllantvrylqcggswredwgqlsgaavppqgaepqsnagprphig
dtlftlfrapellapngdlynvfawaldvlakrlrsmhvfildydqspagcrdallqlts
gmvqthvttpgsipticdlartfaremge

Sequence, based on observed residues (ATOM records): (download)

>d1kinb_ c.37.1.1 (B:) automated matches {Herpes simplex virus type i}
mptllrvyidgphgmgkttttqllvalgdivyvpepmtywrvlgasetianiyttqhrld
qgeisagdaavvmtsaqitmgmpyavtdavlaphiggeagssapppaltlifdrhpiaal
lcypaarylmgsmtpqavlafvalipptlpgtnivlgalpedrhidrlakrqrpgerldl
amlaairrvygllantvrylqcggswredwgqlsagprphigdtlftlfrapellapngd
lynvfawaldvlakrlrsmhvfildydqspagcrdallqltsgmvqthvttpgsipticd
lartfaremge

SCOPe Domain Coordinates for d1kinb_:

Click to download the PDB-style file with coordinates for d1kinb_.
(The format of our PDB-style files is described here.)

Timeline for d1kinb_:

  • d1kinb_ is new in SCOPe 2.06-stable