Lineage for d1kc0a_ (1kc0 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2449736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2450365Protein dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) [75102] (2 species)
  7. 2450366Species Salmonella enterica [311157] (1 PDB entry)
  8. 2450367Domain d1kc0a_: 1kc0 A: [302630]
    automated match to d1kbza_
    complexed with mg, ndp, so4

Details for d1kc0a_

PDB Entry: 1kc0 (more details), 2 Å

PDB Description: Crystal structure of dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) in complex with NADH
PDB Compounds: (A:) dTDP-glucose oxidoreductase

SCOPe Domain Sequences for d1kc0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kc0a_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica}
mnillfgktgqvgwelqrslapvgnlialdvhskefcgdfsnpkgvaetvrklrpdvivn
aaahtavdkaesepelaqllnatsveaiakaanetgawvvhystdyvfpgtgdipwqetd
atsplnvygktklagekalqdncpkhlifrtswvyagkgnnfaktmlrlakerqtlsvin
dqygaptgaelladctahairvalnkpevaglyhlvaggtttwhdyaalvfdearkagit
laltelnavptsayptpasrpgnsrlntekfqrnfdlilpqwelgvkrmltemftttt

SCOPe Domain Coordinates for d1kc0a_:

Click to download the PDB-style file with coordinates for d1kc0a_.
(The format of our PDB-style files is described here.)

Timeline for d1kc0a_: