Lineage for d1hwyb1 (1hwy B:209-501)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845191Protein Glutamate dehydrogenase [51884] (8 species)
  7. 2845199Species Cow (Bos taurus) [TaxId:9913] [51889] (6 PDB entries)
  8. 2845210Domain d1hwyb1: 1hwy B:209-501 [30263]
    Other proteins in same PDB: d1hwya2, d1hwyb2, d1hwyc2, d1hwyd2, d1hwye2, d1hwyf2
    complexed with akg, nad, po4
    has additional insertions and/or extensions that are not grouped together

Details for d1hwyb1

PDB Entry: 1hwy (more details), 3.2 Å

PDB Description: bovine glutamate dehydrogenase complexed with nad and 2-oxoglutarate
PDB Compounds: (B:) glutamate dehydrogenase

SCOPe Domain Sequences for d1hwyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hwyb1 c.2.1.7 (B:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]}
hgrisatgrgvfhgienfienasymsilgmtpgfgdktfavqgfgnvglhsmrylhrfga
kcvavgesdgsiwnpdgidpkeledfklqhgtilgfpkakiyegsilevdcdilipaase
kqltksnaprvkakiiaegangpttpqadkiflernimvipdlylnaggvtvsyfqilkn
lnhvsygrltfkyerdsnyhllmsvqeslerkfgkhggtipivptaefqdrisgasekdi
vhsglaytmersarqimrtamkynlgldlrtaayvnaiekvfrvyneagvtft

SCOPe Domain Coordinates for d1hwyb1:

Click to download the PDB-style file with coordinates for d1hwyb1.
(The format of our PDB-style files is described here.)

Timeline for d1hwyb1: