Lineage for d1kauc2 (1kau C:130-422,C:476-567)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833433Family c.1.9.2: alpha-subunit of urease, catalytic domain [51560] (1 protein)
  6. 2833434Protein alpha-subunit of urease, catalytic domain [51561] (4 species)
  7. 2833453Species Klebsiella aerogenes [TaxId:28451] [51562] (28 PDB entries)
  8. 2833473Domain d1kauc2: 1kau C:130-422,C:476-567 [302629]
    Other proteins in same PDB: d1kaua_, d1kaub_, d1kauc1
    automated match to d1ejxc2
    complexed with cbx, ni

Details for d1kauc2

PDB Entry: 1kau (more details), 2.2 Å

PDB Description: the crystal structure of urease from klebsiella aerogenes at 2.2 angstroms resolution
PDB Compounds: (C:) klebsiella aerogenes urease

SCOPe Domain Sequences for d1kauc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kauc2 c.1.9.2 (C:130-422,C:476-567) alpha-subunit of urease, catalytic domain {Klebsiella aerogenes [TaxId: 28451]}
gidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrmlqaadslpv
nigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdiqvalhsdt
lnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnptlpytlnti
dehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssdsqamgrvge
vilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahevgXmfgalg
sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
evrvdgelitsepadvlpmaqryflf

SCOPe Domain Coordinates for d1kauc2:

Click to download the PDB-style file with coordinates for d1kauc2.
(The format of our PDB-style files is described here.)

Timeline for d1kauc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kauc1