| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.23: FAD-linked oxidoreductase [51730] (3 families) ![]() distinct cofactor-binding mode from both FMN- and NAD(P)-linked TIM-barrel oxidoreductases; families are related by a circular permutation |
| Family c.1.23.2: Proline dehydrohenase domain of bifunctional PutA protein [82279] (2 proteins) automatically mapped to Pfam PF01619 |
| Protein automated matches [226993] (2 species) not a true protein |
| Species Escherichia coli [TaxId:562] [311155] (1 PDB entry) |
| Domain d1k87a4: 1k87 A:262-612 [302615] Other proteins in same PDB: d1k87a3 automated match to d3itga2 complexed with 1pe, fad, gol, lac, trs |
PDB Entry: 1k87 (more details), 2 Å
SCOPe Domain Sequences for d1k87a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k87a4 c.1.23.2 (A:262-612) automated matches {Escherichia coli [TaxId: 562]}
getiaealanarkleekgfrysydmlgeaaltaadaqaymvsyqqaihaigkasngrgiy
egpgisiklsalhprysraqydrvmeelyprlksltllarqydiginidaeeadrleisl
dlleklcfepelagwngigfviqayqkrcplvidylidlatrsrrrlmirlvkgaywdse
ikraqmdglegypvytrkvytdvsylacakkllavpnliypqfathnahtlaaiyqlagq
nyypgqyefqclhgmgeplyeqvtgkvadgklnrpcriyapvgthetllaylvrrlleng
antsfvnriadtslpldelvadpvtaveklaqqegqtglphpkiplprdly
Timeline for d1k87a4: