Lineage for d1k87a3 (1k87 A:87-261)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014214Fold a.176: N-terminal domain of bifunctional PutA protein [81934] (1 superfamily)
    multihelical; array
  4. 2014215Superfamily a.176.1: N-terminal domain of bifunctional PutA protein [81935] (2 families) (S)
  5. 2014229Family a.176.1.0: automated matches [227131] (1 protein)
    not a true family
  6. 2014230Protein automated matches [226832] (2 species)
    not a true protein
  7. 2014237Species Escherichia coli [TaxId:562] [311154] (1 PDB entry)
  8. 2014238Domain d1k87a3: 1k87 A:87-261 [302614]
    Other proteins in same PDB: d1k87a4
    automated match to d1tj2a1
    complexed with 1pe, fad, gol, lac, trs

Details for d1k87a3

PDB Entry: 1k87 (more details), 2 Å

PDB Description: Crystal structure of E.coli PutA (residues 1-669)
PDB Compounds: (A:) proline dehydrogenase

SCOPe Domain Sequences for d1k87a3:

Sequence, based on SEQRES records: (download)

>d1k87a3 a.176.1.0 (A:87-261) automated matches {Escherichia coli [TaxId: 562]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnwqshigrspslfv
naatwgllftgklvsthneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

Sequence, based on observed residues (ATOM records): (download)

>d1k87a3 a.176.1.0 (A:87-261) automated matches {Escherichia coli [TaxId: 562]}
pqsvsraaitaayrrpeteavsmlleqarlpqpvaeqahklayqladklrnqknasgrag
mvqgllqefslssqegvalmclaeallripdkatrdalirdkisngnrspslfvnaatwg
llftgneaslsrslnriigksgeplirkgvdmamrlmgeqfvt

SCOPe Domain Coordinates for d1k87a3:

Click to download the PDB-style file with coordinates for d1k87a3.
(The format of our PDB-style files is described here.)

Timeline for d1k87a3:

  • d1k87a3 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d1k87a4