Lineage for d1k3pb_ (1k3p B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722943Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2722944Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2722945Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2722946Protein Citrate synthase [48258] (7 species)
  7. 2722966Species Escherichia coli [TaxId:562] [81862] (12 PDB entries)
    Uniprot P00891
  8. 2722982Domain d1k3pb_: 1k3p B: [302613]
    automated match to d1nxea_
    complexed with so4

Details for d1k3pb_

PDB Entry: 1k3p (more details), 2.2 Å

PDB Description: Three Dimensional Structure Analysis of the Type II Citrate Synthase from E.coli
PDB Compounds: (B:) citrate synthase

SCOPe Domain Sequences for d1k3pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3pb_ a.103.1.1 (B:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

SCOPe Domain Coordinates for d1k3pb_:

Click to download the PDB-style file with coordinates for d1k3pb_.
(The format of our PDB-style files is described here.)

Timeline for d1k3pb_: