Class a: All alpha proteins [46456] (289 folds) |
Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.103.1: Citrate synthase [48256] (2 families) |
Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
Protein Citrate synthase [48258] (7 species) |
Species Escherichia coli [TaxId:562] [81862] (12 PDB entries) Uniprot P00891 |
Domain d1k3pa_: 1k3p A: [302612] automated match to d1nxea_ complexed with so4 |
PDB Entry: 1k3p (more details), 2.2 Å
SCOPe Domain Sequences for d1k3pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k3pa_ a.103.1.1 (A:) Citrate synthase {Escherichia coli [TaxId: 562]} adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf ksdikr
Timeline for d1k3pa_: